David Thompson
Associate Professor Adjunct of Epidemiology (Environmental Health)Cards
Contact Info
About
Copy Link
Titles
Associate Professor Adjunct of Epidemiology (Environmental Health)
Appointments
Environmental Health Sciences
Associate Professor AdjunctPrimary
Other Departments & Organizations
Research
Copy Link
Research at a Glance
Yale Co-Authors
Frequent collaborators of David Thompson's published research.
Publications Timeline
A big-picture view of David Thompson's research output by year.
Ying Chen, MD, PhD
Georgia Charkoftaki
Former YSMVasilis Vasiliou, PhD
Rolando Garcia-Milian, MLS, AHIP
Emily Davidson
Reza Aalizadeh
95Publications
5,968Citations
Publications
2026
Update of the Methyltransferase Gene Family: Classification, Evolution and Biological Functions
Katsafadou A, Falnes P, Bruford E, Braschi B, Hanson Q, Hall M, Thompson D, Nebert D, Vasiliou V. Update of the Methyltransferase Gene Family: Classification, Evolution and Biological Functions. Human Genomics 2026, 20: 81. PMID: 41882796, PMCID: PMC13137591, DOI: 10.1186/s40246-026-00949-4.Peer-Reviewed Reviews, Practice Guidelines, Standards, and Consensus StatementsCitationsConceptsbiological functionscatalyzes transferprotein lysine methylationstructural homology groupstransfer of methyl groupshigh-throughput genomicsS-adenosyl-L-methionineMTase genesevolutionary relationshipslysine methylationchromatin structureencode proteinsRNA modificationsgene familyRNA functiongene regulationsubstrate specificityMTasesignal transductionenzymatic mechanismmetabolic pathwaysmethyltransferasedisease associationsdrug targetsbiochemical reactions
2025
Olive tree at the intersection of environment, public health, and One Health: a sustainable path to global wellbeing
Katsafadou A, Prodromou S, Aalizadeh R, White J, Thomaidis N, Vizirianakis I, Anastas P, Kyriakides T, Pastides H, Piscitelli P, Colao A, Thompson D, Vasiliou V. Olive tree at the intersection of environment, public health, and One Health: a sustainable path to global wellbeing. Frontiers In Public Health 2025, 13: 1658525. PMID: 41048290, PMCID: PMC12491241, DOI: 10.3389/fpubh.2025.1658525.Peer-Reviewed Reviews, Practice Guidelines, Standards, and Consensus StatementsAltmetricConceptsolive treesenvironmental impacthuman healtholive by-productsclimate change mitigationhealth benefitssustainable agricultural practiceshuman health benefitsmonounsaturated fatty acidsolive sectorgreenhouse gas emissionsbiodiversity supportecosystem stewardshipby-productsfeed additivesolive oil cultivationanimal nutritioncarbon sequestrationsoil conservationolive oil productionsustainable agriculturefood productslivestock healthantioxidant propertiesecological sustainabilitySynergistic toxicity in alcohol-associated liver disease and PFAS exposure
Stem A, Tieghi R, Chatzi V, Kleinstreuer N, Valvi D, Thompson D, Vasiliou V. Synergistic toxicity in alcohol-associated liver disease and PFAS exposure. Toxicological Sciences 2025, 208: 9-31. PMID: 40737496, PMCID: PMC12599875, DOI: 10.1093/toxsci/kfaf110.Peer-Reviewed Reviews, Practice Guidelines, Standards, and Consensus StatementsCitationsAltmetricConceptsalcohol-associated liver diseaseliver diseasechronic ethanol intakecentral mechanismshepatotoxic effectspolyfluoroalkyl substanceshigh-risk populationoxidative stressdysregulated lipid metabolismethanol intakeliver functionliver injuryacetaldehyde-induced cytotoxicityhepatic functionhepatocellular damageoxidative stress inductionliver pathologyglobal morbiditypathogenic pathwayspolyfluoroalkyl substances exposuresexposure to polyfluoroalkyl substancesfatty acid oxidationhealthcare accesseffects of polyfluoroalkyl substancesmultiple mechanismsLessons learned from aldehyde dehydrogenases as non-P450 aldehyde-oxidizing enzymes: implications for the ‘exposome’ and human health
Lisgara A, Thompson D, Nebert D, Vasiliou V. Lessons learned from aldehyde dehydrogenases as non-P450 aldehyde-oxidizing enzymes: implications for the ‘exposome’ and human health. Expert Opinion On Drug Metabolism & Toxicology 2025, 21: 915-919. PMID: 40591371, PMCID: PMC12882789, DOI: 10.1080/17425255.2025.2524872.Peer-Reviewed Reviews, Practice Guidelines, Standards, and Consensus StatementsCitationsMeSH Keywords and ConceptsConceptsaldehyde dehydrogenasealdehyde-oxidizing enzymesnon-P450ALDH superfamilynitric oxide-related speciesenzymatic diversitygenetic screeningALDH polymorphismscytochrome P450 enzymesredox balancePrecise risk assessmentneurodegenerative diseasesenvironmental stressorsclinical implicationsdetoxication functionenzymeP450 enzymeslifetime environmental exposurestherapeutic targetpolymorphismcellular damagedehydrogenaseenvironmental exposuresclinical relevancehuman healthUpdate of the sideroflexin (SLC56) gene family
Katsafadou A, Nebert D, Krupenko S, Thompson D, Vasiliou V. Update of the sideroflexin (SLC56) gene family. Human Genomics 2025, 19: 69. PMID: 40542427, PMCID: PMC12180156, DOI: 10.1186/s40246-025-00779-w.Peer-Reviewed Reviews, Practice Guidelines, Standards, and Consensus StatementsCitationsAltmetricMeSH Keywords and ConceptsConceptsiron-sulfur cluster assemblymitochondrial iron-regulatedmitochondrial iron homeostasismitochondrial serine transportermitochondrial transmembrane proteinoxidative phosphorylation disorderssolute carrier familyeukaryotic speciesone-carbon metabolismmitochondrial researchgene familymodel organismscellular homeostasisevolutionary trajectoriesmitochondrial metabolismtransmembrane domaincongenital sideroblastic anemiatransmembrane proteinscarrier familysideroflexinheme biosynthesisiron regulationcitrate metabolismmitochondrial functionserine transportAdvancing translational exposomics: bridging genome, exposome and personalized medicine
Sarigiannis D, Karakitsios S, Anesti O, Stem A, Valvi D, Sumner S, Chatzi L, Snyder M, Thompson D, Vasiliou V. Advancing translational exposomics: bridging genome, exposome and personalized medicine. Human Genomics 2025, 19: 48. PMID: 40307849, PMCID: PMC12044731, DOI: 10.1186/s40246-025-00761-6.Peer-Reviewed Reviews, Practice Guidelines, Standards, and Consensus StatementsCitationsAltmetricMeSH Keywords and ConceptsConceptsexposome-wide association studybridge genomicslifestyle exposuresenhancing causal inferencepublic health decision-makingenvironmental health researchhealth decision-makingmulti-omics technologiesgenomic variationgenomic dataassociation studieshealth outcomesbioinformatics approachhealth researchprecision preventiongenetic variabilityexposome dataexposure-response relationshipMulti-Omicsgenomeinternal exposomevulnerable populationscomplex diseasesdisease phenotypepublic health4.09 Aldehyde Dehydrogenases
Vasiliou V, Lisgara A, Krupenko S, Krupenko N, Alayyoub M, Petersen D, Thompson D. 4.09 Aldehyde Dehydrogenases. 2025, 183-210. DOI: 10.1016/b978-0-323-95488-4.00287-4.ChaptersConceptsaldehyde dehydrogenasetransgenic knockout mouse modellate-onset Alzheimer's diseasealdehyde dehydrogenase superfamilyaldehyde dehydrogenase geneNAD(P)+-dependent enzymestype II hyperprolinemiahuman genomedehydrogenase geneknockout mouse modelpoor cancer prognosisexogenous aldehydesmolecular basisspastic paraplegiaphysiological processesAlzheimer's diseaseDe Barsy syndromeclinical phenotypeSjogren-Larsson syndromegenescancer stem cellsdehydrogenaseenzyme inactivationenzymeBarsy syndrome
2024
CYP2E1 in 1,4-dioxane metabolism and liver toxicity: insights from CYP2E1 knockout mice study
Wang Y, Charkoftaki G, Orlicky D, Davidson E, Aalizadeh R, Sun N, Ginsberg G, Thompson D, Vasiliou V, Chen Y. CYP2E1 in 1,4-dioxane metabolism and liver toxicity: insights from CYP2E1 knockout mice study. Archives Of Toxicology 2024, 98: 3241-3257. PMID: 39192018, PMCID: PMC11500436, DOI: 10.1007/s00204-024-03811-5.Peer-Reviewed Original ResearchCitationsAltmetricConceptsCYP2E1-null miceliver toxicitydrinking wateroxidative DNA damageliver carcinogenAbstract1,4-DioxaneDNA damage repair responseimpaired DNA damage repairwater contaminationoxidative stresselevated oxidative stressenvironmental pollutionknockout mouse studiesdamage repair responseCYP2E1-nullmale wildtypeWT miceDNA damageDX exposurerisk assessmentredox dysregulationCYP2E1 inductionliver oxidative stresshigh dosesmouse studiesThe European Union Ban on Microplastics Includes Artificial Turf Crumb Rubber Infill: Other Nations Should Follow Suit
Zuccaro P, Thompson D, de Boer J, Llompart M, Watterson A, Bilott R, Birnbaum L, Vasiliou V. The European Union Ban on Microplastics Includes Artificial Turf Crumb Rubber Infill: Other Nations Should Follow Suit. Environmental Science And Technology 2024, 58: 2591-2594. PMID: 38301275, DOI: 10.1021/acs.est.4c00047.Peer-Reviewed Original ResearchCitationsAltmetricMeSH Keywords and Concepts1,4-Dioxane
Stouffer A, Erickson C, Krick M, Chen Y, Ginsberg G, Loch-Caruso R, Jones R, Madrigal J, Thompson D, Vasliou V. 1,4-Dioxane. 2024, 843-849. DOI: 10.1016/b978-0-12-824315-2.00831-9.Peer-Reviewed Reviews, Practice Guidelines, Standards, and Consensus StatementsConceptspersistent environmental contaminationenvironmental contaminationenvironmental behaviorenvironmental releasechemical intermediateswater solubilitypotential negative health effectsdioxanerecent decadessoilconsumer productsgroundwatercontaminationhealth effectssolventsolubilityintermediatesnegative health effectsstabilizermanagementusesproductsusetoxicityexposure
Get In Touch
Copy Link